PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr007875.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family LBD
Protein Properties Length: 294aa    MW: 31682.7 Da    PI: 7.5598
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr007875.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.61.8e-4281071100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp ++p+kf  vhk+FGasnv k+l++l+ ++r+da++sl+yeAear+rdPvyG+vg+i+ lqq+l++++a+l  +k
  Pbr007875.1   8 PCAACKFLRRKCTQECVFAPYFPPDNPHKFSKVHKVFGASNVAKILNELSASQRDDAVNSLAYEAEARLRDPVYGCVGLISILQQRLKEVQADLFNAK 105
                  7********************************************************************************************98888 PP

       DUF260  99 ee 100
                  +e
  Pbr007875.1 106 KE 107
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7487108IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-428104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MSSSSNSPCA ACKFLRRKCT QECVFAPYFP PDNPHKFSKV HKVFGASNVA KILNELSASQ  60
RDDAVNSLAY EAEARLRDPV YGCVGLISIL QQRLKEVQAD LFNAKKELAT YMGPQAMLSI  120
LQPPTYMAQQ LQGNAFSAVS PYMSPMIGIP TGAASGQLMI REPQQQQIFE AQQLAVAVAA  180
REQQAQDHVR FNSGFDSSPG SVTVGGFTQM AGALGNAVSP SLALGFDSGP YHQIQQQQPH  240
HNPHLHLQLQ SQLLLQTQLP QGQHQAQQSQ QPQLQAKSDP GEEGGGRSVG PSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009366786.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_009366787.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_009366788.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ31e-79LBD36_ARATH; LOB domain-containing protein 36
TrEMBLM5W6J81e-130M5W6J8_PRUPE; Uncharacterized protein
STRINGVIT_07s0197g00020.t013e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.18e-76ASYMMETRIC LEAVES 2-like 1